PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00170.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 388aa    MW: 43817.1 Da    PI: 7.8856
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00170.1_g00016.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.42.3e-52151421128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              l pGfrFhPtdeelv++yL++kve+++l++ + i+++diyk++PwdLpk + ++ekewyf+++rd+ky++++r+nr+t++g+Wkat
  Rsa1.0_00170.1_g00016.1  15 LLPGFRFHPTDEELVSFYLRRKVEHRPLSI-KLITQLDIYKYDPWDLPKFAMTGEKEWYFYCPRDRKYRNSSRPNRVTSAGFWKAT 99 
                              579***************************.89***************7777889******************************* PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+d++++s+ +++ +gl+k+Lvfykgra kg+ktdW+mhe+rl
  Rsa1.0_00170.1_g00016.1 100 GTDRPIYSSeGSKCIGLRKSLVFYKGRAAKGVKTDWMMHEFRL 142
                              ********956677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-5911169IPR003441NAC domain
PROSITE profilePS5100558.2715169IPR003441NAC domain
PfamPF023651.9E-2517142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MGENNGEAKK MEDVLLPGFR FHPTDEELVS FYLRRKVEHR PLSIKLITQL DIYKYDPWDL  60
PKFAMTGEKE WYFYCPRDRK YRNSSRPNRV TSAGFWKATG TDRPIYSSEG SKCIGLRKSL  120
VFYKGRAAKG VKTDWMMHEF RLPSSSTHTL SDTPLSPNDS WAICRIFRKA NTTALKATSH  180
SFASSLPTEG STDTEPYEKP SNTAHIYPGN ILENSVSVNF YKKNMNVTKP RSYYDEKEAT  240
KTSTCTANTP FSYMDFASPA SPGPCLDEQY LRSLLLASQE TQPPQLPKVM NNNDISSFLL  300
NMSSSDSSFL GGYTNQIGSS IDLTTAILAQ EQCPALVNLS QGYQDHQAFS HTLEFGHLTS  360
ASTSVGDQHQ NQKHHMLMES YYSVNLLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-551517317169NO APICAL MERISTEM PROTEIN
1ut4_B3e-551517317169NO APICAL MERISTEM PROTEIN
1ut7_A3e-551517317169NO APICAL MERISTEM PROTEIN
1ut7_B3e-551517317169NO APICAL MERISTEM PROTEIN
3swm_A3e-551517320172NAC domain-containing protein 19
3swm_B3e-551517320172NAC domain-containing protein 19
3swm_C3e-551517320172NAC domain-containing protein 19
3swm_D3e-551517320172NAC domain-containing protein 19
3swp_A3e-551517320172NAC domain-containing protein 19
3swp_B3e-551517320172NAC domain-containing protein 19
3swp_C3e-551517320172NAC domain-containing protein 19
3swp_D3e-551517320172NAC domain-containing protein 19
4dul_A3e-551517317169NAC domain-containing protein 19
4dul_B3e-551517317169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893531e-168AC189353.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB043L15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013665409.10.0PREDICTED: protein FEZ-like, partial
SwissprotQ9ZVH01e-156FEZ_ARATH; Protein FEZ
TrEMBLM4CJL90.0M4CJL9_BRARP; Uncharacterized protein
STRINGBra004403.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30628200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-147NAC family protein